SCOPe 2.08: Domain d1u3va1: 1u3v A:1-162,A:339-374

Lineage for d1u3va1 (1u3v A:1-162,A:339-374)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries)
   Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327

8. Domain d1u3va1: 1u3v A:1-162,A:339-374 [113009]
   Other proteins in same PDB: d1u3va2, d1u3vb2
   complexed with hpl, nad, po4, zn

Details for d1u3va1

PDB Entry: 1u3v, 1.65 Å

PDB Description: crystal structure of human alcohol dehydrogenase beta-1-beta-1 isoform complexed with n-heptylformamide determined to 1.65 angstrom resolution

PDB Compounds: (A:) Alcohol dehydrogenase beta chain

SCOPe Domain Sequences for d1u3va1:

Sequence; same for both SEQRES and ATOM records:

>d1u3va1 b.35.1.2 (A:1-162,A:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp
lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaXkfsldalithvlpfeki
negfdllhsgksirtvltf

Timeline for d1u3va1:

• d1u3va1 first appeared in SCOP 1.71
  
• d1u3va1 appears in SCOPe 2.07