Class b: All beta proteins [48724] (180 folds) |
Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (3 families) |
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
Protein Alcohol dehydrogenase [50137] (9 species) contains a Zn-finger subdomain, residues 94-117 |
Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries) Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327 |
Domain d1u3ub1: 1u3u B:1-162,B:339-374 [113007] Other proteins in same PDB: d1u3ua2, d1u3ub2 complexed with bnf, nad, po4, zn |
PDB Entry: 1u3u (more details), 1.6 Å
SCOPe Domain Sequences for d1u3ub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u3ub1 b.35.1.2 (B:1-162,B:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaXkfsldalithvlpfeki negfdllhsgksirtvltf
Timeline for d1u3ub1: