Lineage for d1u3ua1 (1u3u A:1-162,A:339-374)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558060Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 558061Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 558147Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 558165Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 558267Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (22 PDB entries)
  8. 558270Domain d1u3ua1: 1u3u A:1-162,A:339-374 [113005]
    Other proteins in same PDB: d1u3ua2, d1u3ub2

Details for d1u3ua1

PDB Entry: 1u3u (more details), 1.6 Å

PDB Description: crystal structure of human alcohol dehydrogenase beta-1-beta-1 isoform complexed with n-benzylformamide determined to 1.6 angstrom resolution
PDB Compounds: (A:)

SCOP Domain Sequences for d1u3ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3ua1 b.35.1.2 (A:1-162,A:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp
lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaXkfsldalithvlpfeki
negfdllhsgksirtvltf

SCOP Domain Coordinates for d1u3ua1:

Click to download the PDB-style file with coordinates for d1u3ua1.
(The format of our PDB-style files is described here.)

Timeline for d1u3ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u3ua2