Lineage for d1u3ta2 (1u3t A:163-338)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 574153Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 574171Protein Alcohol dehydrogenase [51737] (9 species)
  7. 574273Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (22 PDB entries)
  8. 574306Domain d1u3ta2: 1u3t A:163-338 [113002]
    Other proteins in same PDB: d1u3ta1, d1u3tb1

Details for d1u3ta2

PDB Entry: 1u3t (more details), 2.49 Å

PDB Description: crystal structure of human alcohol dehydrogenase alpha-alpha isoform complexed with n-cyclopentyl-n-cyclobutylformamide determined to 2.5 angstrom resolution

SCOP Domain Sequences for d1u3ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
asplekvcligcgfstgygsavnvakvtpgstcavfglggvglsaimgckaagaariiav
dinkdkfakakelgatecinpqdykkpiqevlkemtdggvdfsfevigrldtmmasllcc
heacgtsvivgvppdsqnlsmnpmllltgrtwkgailggfkskecvpklvadfmak

SCOP Domain Coordinates for d1u3ta2:

Click to download the PDB-style file with coordinates for d1u3ta2.
(The format of our PDB-style files is described here.)

Timeline for d1u3ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u3ta1