Lineage for d1u3ga_ (1u3g A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 713168Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 713169Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (7 families) (S)
  5. 713334Family c.124.1.6: Methenyltetrahydrofolate synthetase [110520] (3 proteins)
    Pfam PF01812; 5-FTHF cyclo-ligase
  6. 713335Protein 5,10-methenyltetrahydrofolate synthetase homolog MPN348 [110523] (1 species)
  7. 713336Species Mycoplasma pneumoniae [TaxId:2104] [110524] (3 PDB entries)
  8. 713341Domain d1u3ga_: 1u3g A: [112999]
    Structural genomics target
    complexed with adp, mg, po4, thf

Details for d1u3ga_

PDB Entry: 1u3g (more details), 2.5 Å

PDB Description: Structural and Functional Characterization of a 5,10-Methenyltetrahydrofolate Synthetase from Mycoplasma pneumoniae (GI: 13508087)
PDB Compounds: (A:) 5,10-methenyltetrahydrofolate synthetase

SCOP Domain Sequences for d1u3ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3ga_ c.124.1.6 (A:) 5,10-methenyltetrahydrofolate synthetase homolog MPN348 {Mycoplasma pneumoniae [TaxId: 2104]}
mdknalrkqilqkrmalstiekshldqkinqklvafltpkpciktialyepiknevtfvd
fffeflkinqiravypkvisdteiifidqetntfepnqidcfliplvgfnkdnyrlgfgk
gyydrylmqltrqqpkigiaysfqkgdfladpwdvqldliinde

SCOP Domain Coordinates for d1u3ga_:

Click to download the PDB-style file with coordinates for d1u3ga_.
(The format of our PDB-style files is described here.)

Timeline for d1u3ga_: