![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) ![]() |
![]() | Family c.124.1.6: Methenyltetrahydrofolate synthetase [110520] (3 proteins) Pfam PF01812; 5-FTHF cyclo-ligase |
![]() | Protein 5,10-methenyltetrahydrofolate synthetase homolog MPN348 [110523] (1 species) |
![]() | Species Mycoplasma pneumoniae [TaxId:2104] [110524] (3 PDB entries) Uniprot P75430 |
![]() | Domain d1u3ga_: 1u3g A: [112999] Structural genomics target complexed with adp, mg, po4, thf |
PDB Entry: 1u3g (more details), 2.5 Å
SCOPe Domain Sequences for d1u3ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u3ga_ c.124.1.6 (A:) 5,10-methenyltetrahydrofolate synthetase homolog MPN348 {Mycoplasma pneumoniae [TaxId: 2104]} mdknalrkqilqkrmalstiekshldqkinqklvafltpkpciktialyepiknevtfvd fffeflkinqiravypkvisdteiifidqetntfepnqidcfliplvgfnkdnyrlgfgk gyydrylmqltrqqpkigiaysfqkgdfladpwdvqldliinde
Timeline for d1u3ga_: