Lineage for d1u3fb_ (1u3f B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922546Family c.124.1.6: Methenyltetrahydrofolate synthetase [110520] (3 proteins)
    Pfam PF01812; 5-FTHF cyclo-ligase
  6. 2922547Protein 5,10-methenyltetrahydrofolate synthetase homolog MPN348 [110523] (1 species)
  7. 2922548Species Mycoplasma pneumoniae [TaxId:2104] [110524] (3 PDB entries)
    Uniprot P75430
  8. 2922552Domain d1u3fb_: 1u3f B: [112998]
    Structural genomics target
    complexed with adp, mg, po4

Details for d1u3fb_

PDB Entry: 1u3f (more details), 2.5 Å

PDB Description: Structural and Functional Characterization of a 5,10-Methenyltetrahydrofolate Synthetase from Mycoplasma pneumoniae (GI: 13508087)
PDB Compounds: (B:) 5,10-methenyltetrahydrofolate synthetase

SCOPe Domain Sequences for d1u3fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3fb_ c.124.1.6 (B:) 5,10-methenyltetrahydrofolate synthetase homolog MPN348 {Mycoplasma pneumoniae [TaxId: 2104]}
mdknalrkqilqkrmalstiekshldqkinqklvafltpkpciktialyepiknevtfvd
fffeflkinqiravypkvisdteiifidqetntfepnqidcfliplvgfnkdnyrlgfgk
gyydrylmqltrqqpkigiaysfqkgdfladpwdvqldliinde

SCOPe Domain Coordinates for d1u3fb_:

Click to download the PDB-style file with coordinates for d1u3fb_.
(The format of our PDB-style files is described here.)

Timeline for d1u3fb_: