Lineage for d1u3fa_ (1u3f A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 595310Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 595311Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (6 families) (S)
  5. 595442Family c.124.1.6: Methenyltetrahydrofolate synthetase [110520] (3 proteins)
    Pfam 01812; 5-FTHF cyclo-ligase
  6. 595443Protein 5,10-methenyltetrahydrofolate synthetase homolog MPN348 [110523] (1 species)
  7. 595444Species Mycoplasma pneumoniae [TaxId:2104] [110524] (3 PDB entries)
  8. 595447Domain d1u3fa_: 1u3f A: [112997]

Details for d1u3fa_

PDB Entry: 1u3f (more details), 2.5 Å

PDB Description: Structural and Functional Characterization of a 5,10-Methenyltetrahydrofolate Synthetase from Mycoplasma pneumoniae (GI: 13508087)

SCOP Domain Sequences for d1u3fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3fa_ c.124.1.6 (A:) 5,10-methenyltetrahydrofolate synthetase homolog MPN348 {Mycoplasma pneumoniae}
mdknalrkqilqkrmalstiekshldqkinqklvafltpkpciktialyepiknevtfvd
fffeflkinqiravypkvisdteiifidqetntfepnqidcfliplvgfnkdnyrlgfgk
gyydrylmqltrqqpkigiaysfqkgdfladpwdvqldliinde

SCOP Domain Coordinates for d1u3fa_:

Click to download the PDB-style file with coordinates for d1u3fa_.
(The format of our PDB-style files is described here.)

Timeline for d1u3fa_: