SCOPe 2.08: Domain d1u3fa_: 1u3f A:

Lineage for d1u3fa_ (1u3f A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.6: Methenyltetrahydrofolate synthetase [110520] (3 proteins)
   Pfam PF01812; 5-FTHF cyclo-ligase

6. Protein 5,10-methenyltetrahydrofolate synthetase homolog MPN348 [110523] (1 species)

7. Species Mycoplasma pneumoniae [TaxId:2104] [110524] (3 PDB entries)
   Uniprot P75430

8. Domain d1u3fa_: 1u3f A: [112997]
   Structural genomics target
   complexed with adp, mg, po4

Details for d1u3fa_

PDB Entry: 1u3f, 2.5 Å

PDB Description: Structural and Functional Characterization of a 5,10-Methenyltetrahydrofolate Synthetase from Mycoplasma pneumoniae (GI: 13508087)

PDB Compounds: (A:) 5,10-methenyltetrahydrofolate synthetase

SCOPe Domain Sequences for d1u3fa_:

Sequence; same for both SEQRES and ATOM records:

>d1u3fa_ c.124.1.6 (A:) 5,10-methenyltetrahydrofolate synthetase homolog MPN348 {Mycoplasma pneumoniae [TaxId: 2104]}
mdknalrkqilqkrmalstiekshldqkinqklvafltpkpciktialyepiknevtfvd
fffeflkinqiravypkvisdteiifidqetntfepnqidcfliplvgfnkdnyrlgfgk
gyydrylmqltrqqpkigiaysfqkgdfladpwdvqldliinde

Timeline for d1u3fa_:

• d1u3fa_ first appeared in SCOP 1.71
  
• d1u3fa_ appears in SCOPe 2.07