Lineage for d1u2vb1 (1u2v B:147-350)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701285Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) (S)
    duplication contains two domains of this fold
  5. 701286Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 701424Protein Actin-related protein 2, Arp2 [69530] (1 species)
    part of Arp2/3 complex
  7. 701425Species Cow (Bos taurus) [TaxId:9913] [69531] (3 PDB entries)
  8. 701427Domain d1u2vb1: 1u2v B:147-350 [112990]
    Other proteins in same PDB: d1u2va1, d1u2va2, d1u2vc_, d1u2vd1, d1u2vd2, d1u2ve_, d1u2vf_, d1u2vg_
    only the second half is ordered
    complexed with adp, ca

Details for d1u2vb1

PDB Entry: 1u2v (more details), 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ADP and calcium
PDB Compounds: (B:) Actin-related Protein 2

SCOP Domain Sequences for d1u2vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2vb1 c.55.1.1 (B:147-350) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]}
yaqglltgvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnh
sadfetvrmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealf
qphlinvegvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlyl
ervlkgdveklskfkiriedpprr

SCOP Domain Coordinates for d1u2vb1:

Click to download the PDB-style file with coordinates for d1u2vb1.
(The format of our PDB-style files is described here.)

Timeline for d1u2vb1: