Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (11 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
Protein Actin-related protein 3, Arp3 [69528] (1 species) part of Arp2/3 complex |
Species Cow (Bos taurus) [TaxId:9913] [69529] (3 PDB entries) |
Domain d1u2va1: 1u2v A:2-160 [112988] Other proteins in same PDB: d1u2vb1, d1u2vc_, d1u2vd1, d1u2vd2, d1u2ve_, d1u2vf_, d1u2vg_ |
PDB Entry: 1u2v (more details), 2.55 Å
SCOP Domain Sequences for d1u2va1:
Sequence, based on SEQRES records: (download)
>d1u2va1 c.55.1.1 (A:2-160) Actin-related protein 3, Arp3 {Cow (Bos taurus)} agrlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldff igdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpe nreytaeimfesfnvpglyiavqavlalaaswtsrqvge
>d1u2va1 c.55.1.1 (A:2-160) Actin-related protein 3, Arp3 {Cow (Bos taurus)} agrlpacvvdcgtgytklgyagntepqfiipsciaikevmkgvddldffigdeaiekpty atkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfe sfnvpglyiavqavlalaaswtsrqvge
Timeline for d1u2va1: