SCOP 1.71: Domain d1u2va1: 1u2v A:2-160

Lineage for d1u2va1 (1u2v A:2-160)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (11 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin-related protein 3, Arp3 [69528] (1 species)
   part of Arp2/3 complex

7. Species Cow (Bos taurus) [TaxId:9913] [69529] (3 PDB entries)

8. Domain d1u2va1: 1u2v A:2-160 [112988]
   Other proteins in same PDB: d1u2vb1, d1u2vc_, d1u2vd1, d1u2vd2, d1u2ve_, d1u2vf_, d1u2vg_

Details for d1u2va1

PDB Entry: 1u2v, 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ADP and calcium

SCOP Domain Sequences for d1u2va1:

Sequence, based on SEQRES records:

>d1u2va1 c.55.1.1 (A:2-160) Actin-related protein 3, Arp3 {Cow (Bos taurus)}
agrlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldff
igdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpe
nreytaeimfesfnvpglyiavqavlalaaswtsrqvge

Sequence, based on observed residues (ATOM records):

>d1u2va1 c.55.1.1 (A:2-160) Actin-related protein 3, Arp3 {Cow (Bos taurus)}
agrlpacvvdcgtgytklgyagntepqfiipsciaikevmkgvddldffigdeaiekpty
atkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfe
sfnvpglyiavqavlalaaswtsrqvge

Timeline for d1u2va1:

• d1u2va1 is new in SCOP 1.71
  
• d1u2va1 appears in SCOP 1.73
  
• d1u2va1 appears in the current release, SCOPe 2.08