Lineage for d1u2lb1 (1u2l B:422-726)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2720495Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 2720496Protein Catalase-peroxidase KatG [74754] (6 species)
    only the N-terminal CCP-like domain binds heme
  7. 2720497Species Burkholderia pseudomallei [TaxId:28450] [89093] (3 PDB entries)
    Uniprot P13029 Q939D2 35-748
  8. 2720500Domain d1u2lb1: 1u2l B:422-726 [112985]
    Other proteins in same PDB: d1u2la2, d1u2lb2
    C-domain only

Details for d1u2lb1

PDB Entry: 1u2l (more details), 2.3 Å

PDB Description: Crystal structure of the C-terminal domain from the catalase-peroxidase KatG of Escherichia coli (P1)
PDB Compounds: (B:) Peroxidase/catalase HPI

SCOPe Domain Sequences for d1u2lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2lb1 a.93.1.3 (B:422-726) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]}
yigpevpkedliwqdplpqpiynpteqdiidlkfaiadsglsvselvsvawasastfrgg
dkrggangarlalmpqrdwdvnaaavralpvlekiqkesgkasladiivlagvvgvekaa
saaglsihvpfapgrvdarqdqtdiemfellepiadgfrnyrarldvsttesllidkaqq
ltltapemtalvggmrvlganfdgskngvftdrvgvlsndffvnlldmryewkatdeske
lfegrdretgevkftasradlvfgsnsvlravaevyassdahekfvkdfvaawvkvmnld
rfdll

SCOPe Domain Coordinates for d1u2lb1:

Click to download the PDB-style file with coordinates for d1u2lb1.
(The format of our PDB-style files is described here.)

Timeline for d1u2lb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u2lb2