Lineage for d1u2la_ (1u2l A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541091Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 541092Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 541370Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 541371Protein Catalase-peroxidase KatG [74754] (4 species)
    only the N-terminal CCP-like domain binds heme
  7. 541377Species Burkholderia pseudomallei [TaxId:28450] [89093] (5 PDB entries)
  8. 541387Domain d1u2la_: 1u2l A: [112984]

Details for d1u2la_

PDB Entry: 1u2l (more details), 2.3 Å

PDB Description: Crystal structure of the C-terminal domain from the catalase-peroxidase KatG of Escherichia coli (P1)

SCOP Domain Sequences for d1u2la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2la_ a.93.1.3 (A:) Catalase-peroxidase KatG {Burkholderia pseudomallei}
hmyigpevpkedliwqdplpqpiynpteqdiidlkfaiadsglsvselvsvawasastfr
ggdkrggangarlalmpqrdwdvnaaavralpvlekiqkesgkasladiivlagvvgvek
aasaaglsihvpfapgrvdarqdqtdiemfellepiadgfrnyrarldvsttesllidka
qqltltapemtalvggmrvlganfdgskngvftdrvgvlsndffvnlldmryewkatdes
kelfegrdretgevkftasradlvfgsnsvlravaevyassdahekfvkdfvaawvkvmn
ldrfdll

SCOP Domain Coordinates for d1u2la_:

Click to download the PDB-style file with coordinates for d1u2la_.
(The format of our PDB-style files is described here.)

Timeline for d1u2la_:

Domains from other chains:
(mouse over for more information)
d1u2lb_