Lineage for d1u2ka_ (1u2k A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328246Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2328247Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2328762Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 2328763Protein Catalase-peroxidase KatG [74754] (6 species)
    only the N-terminal CCP-like domain binds heme
  7. 2328764Species Burkholderia pseudomallei [TaxId:28450] [89093] (3 PDB entries)
    Uniprot P13029 Q939D2 35-748
  8. 2328765Domain d1u2ka_: 1u2k A: [112983]
    C-domain only

Details for d1u2ka_

PDB Entry: 1u2k (more details), 2 Å

PDB Description: Crystal structure of the C-terminal domain from the catalase-peroxidase KatG of Escherichia coli (I41)
PDB Compounds: (A:) Peroxidase/catalase HPI

SCOPe Domain Sequences for d1u2ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2ka_ a.93.1.3 (A:) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]}
qdplpqpiynpteqdiidlkfaiadsglsvselvsvawasastfrggdkrggangarlal
mpqrdwdvnaaavralpvlekiqkesgkasladiivlagvvgvekaasaaglsihvpfap
grvdarqdqtdiemfellepiadgfrnyrarldvsttesllidkaqqltltapemtalvg
gmrvlganfdgskngvftdrvgvlsndffvnlldmryewkatdeskelfegrdretgevk
ftasradlvfgsnsvlravaevyassdahekfvkdfvaawvkvmnldrfdll

SCOPe Domain Coordinates for d1u2ka_:

Click to download the PDB-style file with coordinates for d1u2ka_.
(The format of our PDB-style files is described here.)

Timeline for d1u2ka_: