Lineage for d1u2jg_ (1u2j G:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541091Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 541092Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 541370Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 541371Protein Catalase-peroxidase KatG [74754] (4 species)
    only the N-terminal CCP-like domain binds heme
  7. 541377Species Burkholderia pseudomallei [TaxId:28450] [89093] (5 PDB entries)
  8. 541395Domain d1u2jg_: 1u2j G: [112981]

Details for d1u2jg_

PDB Entry: 1u2j (more details), 2.3 Å

PDB Description: Crystal structure of the C-terminal domain from the catalase-peroxidase KatG of Escherichia coli (P21 21 21)

SCOP Domain Sequences for d1u2jg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2jg_ a.93.1.3 (G:) Catalase-peroxidase KatG {Burkholderia pseudomallei}
liwqdplpqpiynpteqdiidlkfaiadsglsvselvsvawasastfrggdkrggangar
lalmpqrdwdvnaaavralpvlekiqkesgkasladiivlagvvgvekaasaaglsihvp
fapgrvdarqdqtdiemfellepiadgfrnyrarldvsttesllidkaqqltltapemta
lvggmrvlganfdgskngvftdrvgvlsndffvnlldmryewkatdeskelfegrdretg
evkftasradlvfgsnsvlravaevyassdahekfvkdfvaawvkvmnldrfdll

SCOP Domain Coordinates for d1u2jg_:

Click to download the PDB-style file with coordinates for d1u2jg_.
(The format of our PDB-style files is described here.)

Timeline for d1u2jg_: