Lineage for d1u2jf_ (1u2j F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2720495Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 2720496Protein Catalase-peroxidase KatG [74754] (6 species)
    only the N-terminal CCP-like domain binds heme
  7. 2720497Species Burkholderia pseudomallei [TaxId:28450] [89093] (3 PDB entries)
    Uniprot P13029 Q939D2 35-748
  8. 2720506Domain d1u2jf_: 1u2j F: [112980]
    C-domain only

Details for d1u2jf_

PDB Entry: 1u2j (more details), 2.3 Å

PDB Description: Crystal structure of the C-terminal domain from the catalase-peroxidase KatG of Escherichia coli (P21 21 21)
PDB Compounds: (F:) Peroxidase/catalase HPI

SCOPe Domain Sequences for d1u2jf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2jf_ a.93.1.3 (F:) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]}
liwqdplpqpiynpteqdiidlkfaiadsglsvselvsvawasastfrggdkrggangar
lalmpqrdwdvnaaavralpvlekiqkesgkasladiivlagvvgvekaasaaglsihvp
fapgrvdarqdqtdiemfellepiadgfrnyrarldvsttesllidkaqqltltapemta
lvggmrvlganfdgskngvftdrvgvlsndffvnlldmryewkatdeskelfegrdretg
evkftasradlvfgsnsvlravaevyassdahekfvkdfvaawvkvmnldrfdll

SCOPe Domain Coordinates for d1u2jf_:

Click to download the PDB-style file with coordinates for d1u2jf_.
(The format of our PDB-style files is described here.)

Timeline for d1u2jf_: