![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
![]() | Family c.45.1.4: Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117583] (2 proteins) |
![]() | Protein Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117584] (1 species) |
![]() | Species Selenomonas ruminantium [TaxId:971] [117585] (12 PDB entries) Uniprot Q7WUJ1 34-346 |
![]() | Domain d1u26a1: 1u26 A:23-335 [112973] Other proteins in same PDB: d1u26a2, d1u26b2 complexed with ihs |
PDB Entry: 1u26 (more details), 2.5 Å
SCOPe Domain Sequences for d1u26a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u26a1 c.45.1.4 (A:23-335) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} tvtepvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvps regmdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswygerd wanlgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaag mryfriaatdhvwptpenidrflafyrtlpqdawlhfhceagvgrttafmvmtdmlknps vslkdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyqt pwsvwlkshpaka
Timeline for d1u26a1: