SCOP 1.73: Domain d1u25c_: 1u25 C:

Lineage for d1u25c_ (1u25 C:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.4: Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117583] (1 protein)

6. Protein Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117584] (1 species)

7. Species Selenomonas ruminantium [TaxId:971] [117585] (3 PDB entries)

8. Domain d1u25c_: 1u25 C: [112972]
   complexed with ihs

Details for d1u25c_

PDB Entry: 1u25, 2.5 Å

PDB Description: Crystal structure of Selenomonas ruminantium phytase complexed with persulfated phytate in the C2221 crystal form

PDB Compounds: (C:) myo-inositol hexaphosphate phosphohydrolase

SCOP Domain Sequences for d1u25c_:

Sequence; same for both SEQRES and ATOM records:

>d1u25c_ c.45.1.4 (C:) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]}
epvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvpsreg
mdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswygerdwan
lgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaagmry
friaatdhvwptpenidrflafyrtlpqdawlhfhceagvgrttafmvmtdmlknpsvsl
kdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyqtpws
vwlkshpaka

Timeline for d1u25c_:

• d1u25c_ first appeared in SCOP 1.71
  
• d1u25c_ appears in SCOP 1.75
  
• d1u25c_ appears in the current release, SCOPe 2.08