Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (4 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.4: Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117583] (1 protein) |
Protein Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117584] (1 species) |
Species Selenomonas ruminantium [TaxId:971] [117585] (3 PDB entries) |
Domain d1u25c_: 1u25 C: [112972] complexed with ihs |
PDB Entry: 1u25 (more details), 2.5 Å
SCOP Domain Sequences for d1u25c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u25c_ c.45.1.4 (C:) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium} epvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvpsreg mdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswygerdwan lgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaagmry friaatdhvwptpenidrflafyrtlpqdawlhfhceagvgrttafmvmtdmlknpsvsl kdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyqtpws vwlkshpaka
Timeline for d1u25c_: