SCOP 1.71: Domain d1u24b_: 1u24 B:

Lineage for d1u24b_ (1u24 B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (4 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.4: Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117583] (1 protein)

6. Protein Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117584] (1 species)

7. Species Selenomonas ruminantium [TaxId:971] [117585] (3 PDB entries)

8. Domain d1u24b_: 1u24 B: [112969]

Details for d1u24b_

PDB Entry: 1u24, 2 Å

PDB Description: Crystal structure of Selenomonas ruminantium phytase

SCOP Domain Sequences for d1u24b_:

Sequence; same for both SEQRES and ATOM records:

>d1u24b_ c.45.1.4 (B:) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium}
tvtepvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvps
regmdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswygerd
wanlgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaag
mryfriaatdhvwptpenidrflafyrtlpqdawlhfhceagvgrttafmvmtdmlknps
vslkdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyqt
pwsvwlkshpakal

Timeline for d1u24b_:

• d1u24b_ is new in SCOP 1.71
  
• d1u24b_ appears in SCOP 1.73
  
• d1u24b_ appears in the current release, SCOPe 2.08, called d1u24b1