Lineage for d1u1xb1 (1u1x B:1-128)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021870Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 1021871Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 1021887Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
    Pfam PF02567
  6. 1021914Protein Phenazine biosynthesis protein PhzF [117861] (1 species)
  7. 1021915Species Pseudomonas fluorescens [TaxId:294] [117862] (6 PDB entries)
    Uniprot Q51792
  8. 1021930Domain d1u1xb1: 1u1x B:1-128 [112963]
    complexed with hha

Details for d1u1xb1

PDB Entry: 1u1x (more details), 1.88 Å

PDB Description: Structure and function of phenazine-biosynthesis protein PhzF from Pseudomonas fluorescens 2-79
PDB Compounds: (B:) Phenazine biosynthesis protein phzF

SCOPe Domain Sequences for d1u1xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u1xb1 d.21.1.2 (B:1-128) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens [TaxId: 294]}
mhnyviidafasvplegnpvavffdaddlppaqmqriaremnlsestfvlkprnggdali
riftpvnelpfaghpllgtaialgahtdnhrlyletqmgtiafelerqngsviaasmdqp
iptwtalg

SCOPe Domain Coordinates for d1u1xb1:

Click to download the PDB-style file with coordinates for d1u1xb1.
(The format of our PDB-style files is described here.)

Timeline for d1u1xb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u1xb2