SCOPe 2.07: Domain d1u1xa2: 1u1x A:129-278

Lineage for d1u1xa2 (1u1x A:129-278)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
   Pfam PF02567

6. Protein Phenazine biosynthesis protein PhzF [117861] (1 species)

7. Species Pseudomonas fluorescens [TaxId:294] [117862] (7 PDB entries)
   Uniprot Q51792

8. Domain d1u1xa2: 1u1x A:129-278 [112962]
   Other proteins in same PDB: d1u1xb3
   complexed with hha

Details for d1u1xa2

PDB Entry: 1u1x, 1.88 Å

PDB Description: Structure and function of phenazine-biosynthesis protein PhzF from Pseudomonas fluorescens 2-79

PDB Compounds: (A:) Phenazine biosynthesis protein phzF

SCOPe Domain Sequences for d1u1xa2:

Sequence; same for both SEQRES and ATOM records:

>d1u1xa2 d.21.1.2 (A:129-278) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens [TaxId: 294]}
rdaellkalgisdstfpieiyhngprhvfvglpsidalsalhpdhralsnfhdmaincfa
gagrrwrsrmfspaygvvedaatgsaagplaihlarhgqiefgqpveilqgveigrpslm
fakaegraeqltrvevsgngvtfgrgtivl

Timeline for d1u1xa2:

• d1u1xa2 first appeared in SCOP 1.71
  
• d1u1xa2 appears in SCOPe 2.06
  
• d1u1xa2 appears in the current release, SCOPe 2.08