Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (4 families) duplication: consists of two similar domain swapped with C-terminal strands |
Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins) Pfam PF02567 |
Protein Phenazine biosynthesis protein PhzF [117861] (1 species) |
Species Pseudomonas fluorescens [TaxId:294] [117862] (6 PDB entries) Uniprot Q51792 |
Domain d1u1xa1: 1u1x A:1-128 [112961] |
PDB Entry: 1u1x (more details), 1.88 Å
SCOP Domain Sequences for d1u1xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u1xa1 d.21.1.2 (A:1-128) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens [TaxId: 294]} mhnyviidafasvplegnpvavffdaddlppaqmqriaremnlsestfvlkprnggdali riftpvnelpfaghpllgtaialgahtdnhrlyletqmgtiafelerqngsviaasmdqp iptwtalg
Timeline for d1u1xa1: