![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
![]() | Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) ![]() duplication: consists of two similar domain swapped with C-terminal strands |
![]() | Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins) Pfam PF02567 |
![]() | Protein Phenazine biosynthesis protein PhzF [117861] (1 species) |
![]() | Species Pseudomonas fluorescens [TaxId:294] [117862] (6 PDB entries) Uniprot Q51792 |
![]() | Domain d1u1wb1: 1u1w B:1-128 [112959] complexed with 3ha, act, gol |
PDB Entry: 1u1w (more details), 1.35 Å
SCOPe Domain Sequences for d1u1wb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u1wb1 d.21.1.2 (B:1-128) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens [TaxId: 294]} mhnyviidafasvplegnpvavffdaddlppaqmqriaremnlsestfvlkprnggdali riftpvnelpfaghpllgtaialgahtdnhrlyletqmgtiafelerqngsviaasmdqp iptwtalg
Timeline for d1u1wb1: