Lineage for d1u1wa2 (1u1w A:129-278)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600808Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 600809Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (3 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 600817Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
    Pfam 02567
  6. 600844Protein Phenazine biosynthesis protein PhzF [117861] (1 species)
  7. 600845Species Pseudomonas fluorescens [TaxId:294] [117862] (6 PDB entries)
  8. 600849Domain d1u1wa2: 1u1w A:129-278 [112958]

Details for d1u1wa2

PDB Entry: 1u1w (more details), 1.35 Å

PDB Description: Structure and function of phenazine-biosynthesis protein PhzF from Pseudomonas fluorescens 2-79

SCOP Domain Sequences for d1u1wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u1wa2 d.21.1.2 (A:129-278) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens}
rdaellkalgisdstfpieiyhngprhvfvglpsidalsalhpdhralsnfhdmaincfa
gagrrwrsrmfspaygvvedaatgsaagplaihlarhgqiefgqpveilqgveigrpslm
fakaegraeqltrvevsgngvtfgrgtivl

SCOP Domain Coordinates for d1u1wa2:

Click to download the PDB-style file with coordinates for d1u1wa2.
(The format of our PDB-style files is described here.)

Timeline for d1u1wa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u1wa1