SCOP 1.75: Domain d1u19a_: 1u19 A:

Lineage for d1u19a_ (1u19 A:)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (2 families)

5. Family f.13.1.2: Rhodopsin-like [81320] (1 protein)
   Individual TM segments have a number of kinks and distortions

6. Protein Rhodopsin [56876] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56877] (10 PDB entries)
   Uniprot P02699

8. Domain d1u19a_: 1u19 A: [112953]

Details for d1u19a_

PDB Entry: 1u19, 2.2 Å

PDB Description: crystal structure of bovine rhodopsin at 2.2 angstroms resolution

PDB Compounds: (A:) rhodopsin

SCOP Domain Sequences for d1u19a_:

Sequence; same for both SEQRES and ATOM records:

>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]}
mngtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip
egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqes
attqkaekevtrmviimviaflicwlpyagvafyifthqgsdfgpifmtipaffaktsav
ynpviyimmnkqfrncmvttlccgknplgddeasttvsktetsqvapa

Timeline for d1u19a_:

• d1u19a_ first appeared in SCOP 1.71
  
• d1u19a_ appears in SCOP 1.73
  
• d1u19a_ appears in SCOPe 2.01
  
• d1u19a_ appears in the current release, SCOPe 2.08