Lineage for d1u16a_ (1u16 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010257Family a.127.1.1: L-aspartase/fumarase [48558] (6 protein domains)
  6. 2010279Protein Argininosuccinate lyase/delta-crystallin [48564] (4 species)
  7. 2010280Species Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId:8839] [48566] (10 PDB entries)
    Uniprot P24058 P24057
  8. 2010299Domain d1u16a_: 1u16 A: [112952]
    complexed with cl, mes, so4; mutant

Details for d1u16a_

PDB Entry: 1u16 (more details), 2.2 Å

PDB Description: Crystal structure of a duck-delta-crystallin-1 double loop mutant (DLM) in complex with sulfate
PDB Compounds: (A:) delta crystallin I

SCOPe Domain Sequences for d1u16a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u16a_ a.127.1.1 (A:) Argininosuccinate lyase/delta-crystallin {Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId: 8839]}
stdpimeklnssiaydqrlsevdiqasiayakalekagiltktelekilsglekiseews
kgvfvvkqsdedihtanerrlkeligdiagklhtgrsrneqvvtdlklfmknslsiisth
llqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkkrin
vlplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsvatlllihlsk
maedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlk
glpstynkdlqedkeavidvvdtltavlqvatgvistlqiskenmekaltpemlatdlal
ylvrkgmpfrqahtasgkavhlaetkgiainnltledlksisplfssdvsqvfnfvnsve
qytalggtakssvttqieqlrelmkkqke

SCOPe Domain Coordinates for d1u16a_:

Click to download the PDB-style file with coordinates for d1u16a_.
(The format of our PDB-style files is described here.)

Timeline for d1u16a_: