SCOPe 2.08: Domain d1u12b_: 1u12 B:

Lineage for d1u12b_ (1u12 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein Putative ion channel CnbD [110321] (1 species)

7. Species Mesorhizobium loti [TaxId:381] [110322] (3 PDB entries)
   Uniprot Q98GN8 218-350 # mll3241

8. Domain d1u12b_: 1u12 B: [112947]
   complexed with iod, k, so4; mutant

Details for d1u12b_

PDB Entry: 1u12, 2.7 Å

PDB Description: m. loti cyclic nucleotide binding domain mutant

PDB Compounds: (B:) cyclic nucleotide binding domain

SCOPe Domain Sequences for d1u12b_:

Sequence; same for both SEQRES and ATOM records:

>d1u12b_ b.82.3.2 (B:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]}
gdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvvegsv
svatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspeiaei
frktale

Timeline for d1u12b_:

• d1u12b_ first appeared in SCOP 1.71
  
• d1u12b_ appears in SCOPe 2.07