Lineage for d1u12a_ (1u12 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2816658Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2816664Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 2816780Protein Putative ion channel CnbD [110321] (1 species)
  7. 2816781Species Mesorhizobium loti [TaxId:381] [110322] (3 PDB entries)
    Uniprot Q98GN8 218-350 # mll3241
  8. 2816785Domain d1u12a_: 1u12 A: [112946]
    complexed with iod, k, so4; mutant

Details for d1u12a_

PDB Entry: 1u12 (more details), 2.7 Å

PDB Description: m. loti cyclic nucleotide binding domain mutant
PDB Compounds: (A:) cyclic nucleotide binding domain

SCOPe Domain Sequences for d1u12a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u12a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]}
rrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvveg
svsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspeia
eifrktalear

SCOPe Domain Coordinates for d1u12a_:

Click to download the PDB-style file with coordinates for d1u12a_.
(The format of our PDB-style files is described here.)

Timeline for d1u12a_: