Lineage for d1u0wd2 (1u0w D:235-389)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846958Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 846959Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 847355Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins)
  6. 847392Protein Chalcone synthase [53915] (1 species)
  7. 847393Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (16 PDB entries)
    Uniprot P30074
  8. 847437Domain d1u0wd2: 1u0w D:235-389 [112945]
    complexed with stl; mutant

Details for d1u0wd2

PDB Entry: 1u0w (more details), 2 Å

PDB Description: an aldol switch discovered in stilbene synthases mediates cyclization specificity of type iii polyketide synthases: 18xchs+resveratrol structure
PDB Compounds: (D:) Chalcone synthase 2

SCOP Domain Sequences for d1u0wd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0wd2 c.95.1.2 (D:235-389) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]}
pifemvwtaqtiapdsegaidghlreagltfhlkgavpdivsknitkalveafeplgisd
ynsifwiahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkst
qnglkttgeglewgvlfgfgpgltietvvlrsvai

SCOP Domain Coordinates for d1u0wd2:

Click to download the PDB-style file with coordinates for d1u0wd2.
(The format of our PDB-style files is described here.)

Timeline for d1u0wd2: