| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (2 families) ![]() |
| Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins) |
| Protein Chalcone synthase [53915] (1 species) |
| Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (16 PDB entries) Uniprot P30074 |
| Domain d1u0wd2: 1u0w D:235-389 [112945] complexed with stl; mutant |
PDB Entry: 1u0w (more details), 2 Å
SCOP Domain Sequences for d1u0wd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u0wd2 c.95.1.2 (D:235-389) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]}
pifemvwtaqtiapdsegaidghlreagltfhlkgavpdivsknitkalveafeplgisd
ynsifwiahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkst
qnglkttgeglewgvlfgfgpgltietvvlrsvai
Timeline for d1u0wd2: