![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) |
![]() | Domain d1u0wb2: 1u0w B:235-389 [112941] Other proteins in same PDB: d1u0wa1, d1u0wb1, d1u0wc1, d1u0wd1 complexed with stl |
PDB Entry: 1u0w (more details), 2 Å
SCOPe Domain Sequences for d1u0wb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u0wb2 c.95.1.2 (B:235-389) Chalcone synthase, C-terminal domain {Alfalfa (Medicago sativa) [TaxId: 3879]} pifemvwtaqtiapdsegaidghlreagltfhlkgavpdivsknitkalveafeplgisd ynsifwiahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkst qnglkttgeglewgvlfgfgpgltietvvlrsvai
Timeline for d1u0wb2: