Lineage for d1u0wb1 (1u0w B:10-234)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916987Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
  6. 2917079Protein Chalcone synthase, N-terminal domain [419030] (1 species)
  7. 2917080Species Alfalfa (Medicago sativa) [TaxId:3879] [419514] (16 PDB entries)
    Uniprot P30074
  8. 2917092Domain d1u0wb1: 1u0w B:10-234 [112940]
    Other proteins in same PDB: d1u0wa2, d1u0wb2, d1u0wc2, d1u0wd2
    complexed with stl
    has additional insertions and/or extensions that are not grouped together

Details for d1u0wb1

PDB Entry: 1u0w (more details), 2 Å

PDB Description: an aldol switch discovered in stilbene synthases mediates cyclization specificity of type iii polyketide synthases: 18xchs+resveratrol structure
PDB Compounds: (B:) Chalcone synthase 2

SCOPe Domain Sequences for d1u0wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0wb1 c.95.1.2 (B:10-234) Chalcone synthase, N-terminal domain {Alfalfa (Medicago sativa) [TaxId: 3879]}
aqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmcdksmikrry
mylteeilkenpnvceymapsldarqamlamevprlgkeaavkaikewgqpkskithliv
cstttpdlpgadyqltkllglrpyvkrvgvfqhgcfaggtvlrlakdlaennkgarvlvv
csevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiek

SCOPe Domain Coordinates for d1u0wb1:

Click to download the PDB-style file with coordinates for d1u0wb1.
(The format of our PDB-style files is described here.)

Timeline for d1u0wb1: