SCOPe 2.08: Domain d1u0vb1: 1u0v B:10-234

Lineage for d1u0vb1 (1u0v B:10-234)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)

6. Protein Chalcone synthase, N-terminal domain [419030] (1 species)

7. Species Alfalfa (Medicago sativa) [TaxId:3879] [419514] (16 PDB entries)
   Uniprot P30074

8. Domain d1u0vb1: 1u0v B:10-234 [112936]
   Other proteins in same PDB: d1u0va2, d1u0vb2
   has additional insertions and/or extensions that are not grouped together

Details for d1u0vb1

PDB Entry: 1u0v, 1.9 Å

PDB Description: an aldol switch discovered in stilbene synthases mediates cyclization of specificity of type iii polyketide synthases: 18xchs structure

PDB Compounds: (B:) Chalcone synthase 2

SCOPe Domain Sequences for d1u0vb1:

Sequence; same for both SEQRES and ATOM records:

>d1u0vb1 c.95.1.2 (B:10-234) Chalcone synthase, N-terminal domain {Alfalfa (Medicago sativa) [TaxId: 3879]}
aqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmcdksmikrry
mylteeilkenpnvceymapsldarqamlamevprlgkeaavkaikewgqpkskithliv
cstttpdlpgadyqltkllglrpyvkrvgvfqhgcfaggtvlrlakdlaennkgarvlvv
csevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiek

Timeline for d1u0vb1:

• d1u0vb1 first appeared in SCOP 1.71
  
• d1u0vb1 appears in SCOPe 2.07