SCOP 1.71: Domain d1u0uf1: 1u0u F:5-237

Lineage for d1u0uf1 (1u0u F:5-237)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins)

6. Protein Dihydropinosylvin synthase [117752] (1 species)

7. Species Scots pine (Pinus sylvestris) [TaxId:3349] [117753] (1 PDB entry)

8. Domain d1u0uf1: 1u0u F:5-237 [112932]

Details for d1u0uf1

PDB Entry: 1u0u, 2.11 Å

PDB Description: an aldol switch discovered in stilbene synthases mediates cyclization specificity of type iii polyketide synthases: pine stilbene synthase structure

SCOP Domain Sequences for d1u0uf1:

Sequence; same for both SEQRES and ATOM records:

>d1u0uf1 c.95.1.2 (F:5-237) Dihydropinosylvin synthase {Scots pine (Pinus sylvestris)}
dfegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkdkfkricer
saikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaekaiqewgqsk
sgithlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrmakdlaenn
rgarvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqvek

Timeline for d1u0uf1:

• d1u0uf1 is new in SCOP 1.71
  
• d1u0uf1 appears in SCOP 1.73
  
• d1u0uf1 appears in the current release, SCOPe 2.08