Lineage for d1u0ue2 (1u0u E:238-393)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916987Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
  6. Protein Dihydropinosylvin synthase, C-terminal domain [419033] (1 species)
  7. Species Scots pine (Pinus sylvestris) [TaxId:3349] [419517] (1 PDB entry)
    Uniprot Q02323
  8. 2917112Domain d1u0ue2: 1u0u E:238-393 [112931]
    Other proteins in same PDB: d1u0ua1, d1u0ub1, d1u0uc1, d1u0ud1, d1u0ue1, d1u0uf1

Details for d1u0ue2

PDB Entry: 1u0u (more details), 2.11 Å

PDB Description: an aldol switch discovered in stilbene synthases mediates cyclization specificity of type iii polyketide synthases: pine stilbene synthase structure
PDB Compounds: (E:) Dihydropinosylvin synthase

SCOPe Domain Sequences for d1u0ue2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0ue2 c.95.1.2 (E:238-393) Dihydropinosylvin synthase, C-terminal domain {Scots pine (Pinus sylvestris) [TaxId: 3349]}
acfeivwtaqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkisd
wnklfwvvhpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkasl
qngcsttgeglemgvlfgfgpgltietvvlksvpiq

SCOPe Domain Coordinates for d1u0ue2:

Click to download the PDB-style file with coordinates for d1u0ue2.
(The format of our PDB-style files is described here.)

Timeline for d1u0ue2: