Lineage for d1u0ue1 (1u0u E:5-237)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916987Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
  6. 2917114Protein Dihydropinosylvin synthase, N-terminal domain [419032] (1 species)
  7. 2917115Species Scots pine (Pinus sylvestris) [TaxId:3349] [419516] (1 PDB entry)
    Uniprot Q02323
  8. 2917120Domain d1u0ue1: 1u0u E:5-237 [112930]
    Other proteins in same PDB: d1u0ua2, d1u0ub2, d1u0uc2, d1u0ud2, d1u0ue2, d1u0uf2
    has additional insertions and/or extensions that are not grouped together

Details for d1u0ue1

PDB Entry: 1u0u (more details), 2.11 Å

PDB Description: an aldol switch discovered in stilbene synthases mediates cyclization specificity of type iii polyketide synthases: pine stilbene synthase structure
PDB Compounds: (E:) Dihydropinosylvin synthase

SCOPe Domain Sequences for d1u0ue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0ue1 c.95.1.2 (E:5-237) Dihydropinosylvin synthase, N-terminal domain {Scots pine (Pinus sylvestris) [TaxId: 3349]}
dfegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkdkfkricer
saikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaekaiqewgqsk
sgithlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrmakdlaenn
rgarvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqvek

SCOPe Domain Coordinates for d1u0ue1:

Click to download the PDB-style file with coordinates for d1u0ue1.
(The format of our PDB-style files is described here.)

Timeline for d1u0ue1: