Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) |
Protein Dihydropinosylvin synthase, N-terminal domain [419032] (1 species) |
Species Scots pine (Pinus sylvestris) [TaxId:3349] [419516] (1 PDB entry) Uniprot Q02323 |
Domain d1u0ue1: 1u0u E:5-237 [112930] Other proteins in same PDB: d1u0ua2, d1u0ub2, d1u0uc2, d1u0ud2, d1u0ue2, d1u0uf2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1u0u (more details), 2.11 Å
SCOPe Domain Sequences for d1u0ue1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u0ue1 c.95.1.2 (E:5-237) Dihydropinosylvin synthase, N-terminal domain {Scots pine (Pinus sylvestris) [TaxId: 3349]} dfegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkdkfkricer saikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaekaiqewgqsk sgithlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrmakdlaenn rgarvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqvek
Timeline for d1u0ue1: