SCOPe 2.05: Domain d1u0hc2: 1u0h C:39-65,C:202-388

Lineage for d1u0hc2 (1u0h C:39-65,C:202-388)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Cow (Bos taurus) [TaxId:9913] [52624] (18 PDB entries)
   Uniprot P04896 39-388

8. Domain d1u0hc2: 1u0h C:39-65,C:202-388 [112919]
   Other proteins in same PDB: d1u0ha_, d1u0hb_, d1u0hc1
   complexed with cl, fok, gsp, mg, onm

Details for d1u0hc2

PDB Entry: 1u0h, 2.9 Å

PDB Description: structural basis for the inhibition of mammalian adenylyl cyclase by mant-gtp

PDB Compounds: (C:) Guanine nucleotide-binding protein G(s), alpha subunit

SCOPe Domain Sequences for d1u0hc2:

Sequence; same for both SEQRES and ATOM records:

>d1u0hc2 c.37.1.8 (C:39-65,C:202-388) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk
wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk
qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg
dgrhycyphftcavdtenirrvfndcrdiiqrmhl

Timeline for d1u0hc2:

• d1u0hc2 first appeared in SCOP 1.71
  
• d1u0hc2 appears in SCOPe 2.04
  
• d1u0hc2 appears in SCOPe 2.06
  
• d1u0hc2 appears in the current release, SCOPe 2.08