SCOP 1.75: Domain d1u0hc1: 1u0h C:86-201

Lineage for d1u0hc1 (1u0h C:86-201)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47898] (15 PDB entries)

8. Domain d1u0hc1: 1u0h C:86-201 [112918]
   Other proteins in same PDB: d1u0ha_, d1u0hb_, d1u0hc2
   complexed with cl, fok, gsp, mg, onm

Details for d1u0hc1

PDB Entry: 1u0h, 2.9 Å

PDB Description: structural basis for the inhibition of mammalian adenylyl cyclase by mant-gtp

PDB Compounds: (C:) Guanine nucleotide-binding protein G(s), alpha subunit

SCOP Domain Sequences for d1u0hc1:

Sequence; same for both SEQRES and ATOM records:

>d1u0hc1 a.66.1.1 (C:86-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
gekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppe
fyehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr

Timeline for d1u0hc1:

• d1u0hc1 first appeared in SCOP 1.71
  
• d1u0hc1 appears in SCOP 1.73
  
• d1u0hc1 appears in SCOPe 2.01
  
• d1u0hc1 appears in the current release, SCOPe 2.08