Class a: All alpha proteins [46456] (284 folds) |
Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) this domain interrupts the G-protein common fold |
Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [47898] (15 PDB entries) |
Domain d1u0hc1: 1u0h C:86-201 [112918] Other proteins in same PDB: d1u0ha_, d1u0hb_, d1u0hc2 complexed with cl, fok, gsp, mg, onm |
PDB Entry: 1u0h (more details), 2.9 Å
SCOP Domain Sequences for d1u0hc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u0hc1 a.66.1.1 (C:86-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} gekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppe fyehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr
Timeline for d1u0hc1: