Lineage for d1u0hc1 (1u0h C:86-201)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000132Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 2000133Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 2000134Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 2000135Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 2000136Species Cow (Bos taurus) [TaxId:9913] [47898] (18 PDB entries)
  8. 2000157Domain d1u0hc1: 1u0h C:86-201 [112918]
    Other proteins in same PDB: d1u0ha_, d1u0hb_, d1u0hc2
    complexed with cl, fok, gsp, mg, onm

Details for d1u0hc1

PDB Entry: 1u0h (more details), 2.9 Å

PDB Description: structural basis for the inhibition of mammalian adenylyl cyclase by mant-gtp
PDB Compounds: (C:) Guanine nucleotide-binding protein G(s), alpha subunit

SCOPe Domain Sequences for d1u0hc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0hc1 a.66.1.1 (C:86-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
gekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppe
fyehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr

SCOPe Domain Coordinates for d1u0hc1:

Click to download the PDB-style file with coordinates for d1u0hc1.
(The format of our PDB-style files is described here.)

Timeline for d1u0hc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u0hc2