SCOP 1.71: Domain d1u0ha_: 1u0h A:

Lineage for d1u0ha_ (1u0h A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (2 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins)
   Pfam 00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein Adenylyl cyclase VC1, domain C1a [55077] (1 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [55078] (9 PDB entries)

8. Domain d1u0ha_: 1u0h A: [112916]
   Other proteins in same PDB: d1u0hb_, d1u0hc1, d1u0hc2
   complexed with cl, fok, gsp, mg, onm

Details for d1u0ha_

PDB Entry: 1u0h, 2.9 Å

PDB Description: structural basis for the inhibition of mammalian adenylyl cyclase by mant-gtp

SCOP Domain Sequences for d1u0ha_:

Sequence; same for both SEQRES and ATOM records:

>d1u0ha_ d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris)}
mmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclrik
ilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcgv
lglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylke
hsietflil

Timeline for d1u0ha_:

• d1u0ha_ is new in SCOP 1.71
  
• d1u0ha_ appears in SCOP 1.73
  
• d1u0ha_ appears in the current release, SCOPe 2.08