Lineage for d1u0eb1 (1u0e B:1-555)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140302Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 protein domains)
    permutation of the double-SIS domain fold
    automatically mapped to Pfam PF00342
  6. 2140303Protein Phosphoglucose isomerase, PGI [53702] (8 species)
    moonlights as neuroleukin, autocrine motility factor, and differentiation mediator
  7. 2140329Species Mouse (Mus musculus) [TaxId:10090] [117732] (3 PDB entries)
    Uniprot P06745
  8. 2140333Domain d1u0eb1: 1u0e B:1-555 [112911]
    Other proteins in same PDB: d1u0ea2, d1u0eb2
    complexed with bme, gol, so4

Details for d1u0eb1

PDB Entry: 1u0e (more details), 1.6 Å

PDB Description: Crystal structure of mouse phosphoglucose isomerase
PDB Compounds: (B:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d1u0eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0eb1 c.80.1.2 (B:1-555) Phosphoglucose isomerase, PGI {Mouse (Mus musculus) [TaxId: 10090]}
aaltrnpqfqkllewhransanlklrelfeadperfnnfslnlntnhghilvdysknlvn
kevmqmlvelaksrgveaardnmfsgskinytedravlhvalrnrsntpikvdgkdvmpe
vnrvldkmksfcqrvrsgdwkgytgksitdiinigiggsdlgplmvtealkpyskggprv
wfvsnidgthiaktlaslspetslfiiasktfttqetitnaetakewfleaakdpsavak
hfvalstntakvkefgidpqnmlefwdwvggryslwsaiglsialhvgfdhfeqllsgah
wmdqhflktpleknapvllallgiwyincygcethallpydqymhrfaayfqqgdmesng
kyitksgarvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkglh
hkillanflaqtealmkgklpeearkelqaagkspedlekllphkvfegnrptnsivftk
ltpfilgaliamyehkifvqgimwdinsfdqwgvelgkqlakkiepelegssavtshdss
tnglisfikqqrdtk

SCOPe Domain Coordinates for d1u0eb1:

Click to download the PDB-style file with coordinates for d1u0eb1.
(The format of our PDB-style files is described here.)

Timeline for d1u0eb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u0eb2