Lineage for d1u0ea_ (1u0e A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 592149Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 592150Superfamily c.80.1: SIS domain [53697] (3 families) (S)
  5. 592177Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (1 protein)
    permutation of the double-SIS domain fold
  6. 592178Protein Phosphoglucose isomerase, PGI [53702] (6 species)
    moonlights as neuroleukin, autocrine motility factor, and differentiation mediator
  7. 592202Species Mouse (Mus musculus) [TaxId:10090] [117732] (3 PDB entries)
  8. 592205Domain d1u0ea_: 1u0e A: [112910]

Details for d1u0ea_

PDB Entry: 1u0e (more details), 1.6 Å

PDB Description: Crystal structure of mouse phosphoglucose isomerase

SCOP Domain Sequences for d1u0ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0ea_ c.80.1.2 (A:) Phosphoglucose isomerase, PGI {Mouse (Mus musculus)}
aaltrnpqfqkllewhransanlklrelfeadperfnnfslnlntnhghilvdysknlvn
kevmqmlvelaksrgveaardnmfsgskinytedravlhvalrnrsntpikvdgkdvmpe
vnrvldkmksfcqrvrsgdwkgytgksitdiinigiggsdlgplmvtealkpyskggprv
wfvsnidgthiaktlaslspetslfiiasktfttqetitnaetakewfleaakdpsavak
hfvalstntakvkefgidpqnmlefwdwvggryslwsaiglsialhvgfdhfeqllsgah
wmdqhflktpleknapvllallgiwyincygcethallpydqymhrfaayfqqgdmesng
kyitksgarvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkglh
hkillanflaqtealmkgklpeearkelqaagkspedlekllphkvfegnrptnsivftk
ltpfilgaliamyehkifvqgimwdinsfdqwgvelgkqlakkiepelegssavtshdss
tnglisfikqqrdtkl

SCOP Domain Coordinates for d1u0ea_:

Click to download the PDB-style file with coordinates for d1u0ea_.
(The format of our PDB-style files is described here.)

Timeline for d1u0ea_: