Lineage for d1u0da_ (1u0d A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1662475Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 1662486Superfamily d.95.2: Homing endonucleases [55608] (3 families) (S)
  5. 1662487Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
    contains two extra helices in the C-terminal extension
  6. 1662494Protein DNA endonuclease I-CreI [55610] (1 species)
  7. 1662495Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [55611] (11 PDB entries)
    Uniprot P05725 2-154 ! Uniprot P05725
  8. 1662514Domain d1u0da_: 1u0d A: [112908]
    protein/DNA complex; mutant

Details for d1u0da_

PDB Entry: 1u0d (more details), 2.9 Å

PDB Description: Y33H Mutant of Homing endonuclease I-CreI
PDB Compounds: (A:) DNA endonuclease I-crei

SCOPe Domain Sequences for d1u0da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0da_ d.95.2.1 (A:) DNA endonuclease I-CreI {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ntkynkefllylagfvdgdgsiiaqikpnqshkfkhqlsltfqvtektqrrwfldklvde
igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
flevctwvdqiaalndsktrkttsetvravld

SCOPe Domain Coordinates for d1u0da_:

Click to download the PDB-style file with coordinates for d1u0da_.
(The format of our PDB-style files is described here.)

Timeline for d1u0da_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1u0db_