Lineage for d1u0cb_ (1u0c B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1919359Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 1919370Superfamily d.95.2: Homing endonucleases [55608] (3 families) (S)
  5. 1919371Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
    contains two extra helices in the C-terminal extension
  6. 1919378Protein DNA endonuclease I-CreI [55610] (1 species)
  7. 1919379Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [55611] (11 PDB entries)
    Uniprot P05725 2-154 ! Uniprot P05725
  8. 1919393Domain d1u0cb_: 1u0c B: [112907]
    protein/DNA complex; complexed with mg; mutant

Details for d1u0cb_

PDB Entry: 1u0c (more details), 2.5 Å

PDB Description: Y33C Mutant of Homing endonuclease I-CreI
PDB Compounds: (B:) DNA endonuclease I-crei

SCOPe Domain Sequences for d1u0cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0cb_ d.95.2.1 (B:) DNA endonuclease I-CreI {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ntkynkefllylagfvdgdgsiiaqikpnqsckfkhqlsltfqvtektqrrwfldklvde
igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
flevctwvdqiaalndsktrkttsetvravld

SCOPe Domain Coordinates for d1u0cb_:

Click to download the PDB-style file with coordinates for d1u0cb_.
(The format of our PDB-style files is described here.)

Timeline for d1u0cb_: