![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.95: Homing endonuclease-like [55603] (2 superfamilies) alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243 |
![]() | Superfamily d.95.2: Homing endonucleases [55608] (2 families) ![]() |
![]() | Family d.95.2.1: Group I mobile intron endonuclease [55609] (5 proteins) contains two extra helices in the C-terminal extension |
![]() | Protein DNA endonuclease I-CreI [55610] (1 species) |
![]() | Species Chlamydomonas reinhardtii [TaxId:3055] [55611] (11 PDB entries) |
![]() | Domain d1u0cb_: 1u0c B: [112907] complexed with mg |
PDB Entry: 1u0c (more details), 2.5 Å
SCOP Domain Sequences for d1u0cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u0cb_ d.95.2.1 (B:) DNA endonuclease I-CreI {Chlamydomonas reinhardtii} ntkynkefllylagfvdgdgsiiaqikpnqsckfkhqlsltfqvtektqrrwfldklvde igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk flevctwvdqiaalndsktrkttsetvravld
Timeline for d1u0cb_: