SCOP 1.71: Domain d1u07b_: 1u07 B:

Lineage for d1u07b_ (1u07 B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily)
   beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer

4. Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (2 families)

5. Family d.212.1.2: TonB [64326] (1 protein)
   isolated domain can form different segment-swapped dimers depending on the fragment length

6. Protein TonB [64327] (1 species)

7. Species Escherichia coli [TaxId:562] [64328] (3 PDB entries)

8. Domain d1u07b_: 1u07 B: [112903]
   significant structural changes compared to shorter C-terminal fragments; monomer is structurally similar to the TolA domain

Details for d1u07b_

PDB Entry: 1u07, 1.13 Å

PDB Description: crystal structure of the 92-residue c-term. part of tonb with significant structural changes compared to shorter fragments

SCOP Domain Sequences for d1u07b_:

Sequence; same for both SEQRES and ATOM records:

>d1u07b_ d.212.1.2 (B:) TonB {Escherichia coli}
gpralsrnqpqyparaqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevknamr
rwryepgkpgsgivvnilfkingtteiq

Timeline for d1u07b_:

• d1u07b_ is new in SCOP 1.71
  
• d1u07b_ appears in SCOP 1.73
  
• d1u07b_ appears in the current release, SCOPe 2.08