![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins) |
![]() | Protein Hypothetical protein Bll6730 [117384] (1 species) |
![]() | Species Bradyrhizobium japonicum [TaxId:375] [117385] (3 PDB entries) Uniprot Q89FH0 |
![]() | Domain d1tzzb1: 1tzz B:2146-2392 [112898] Other proteins in same PDB: d1tzza2, d1tzzb2 Structural genomics target complexed with mg |
PDB Entry: 1tzz (more details), 1.86 Å
SCOP Domain Sequences for d1tzzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tzzb1 c.1.11.2 (B:2146-2392) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]} kanprvfvyaaggyyypgkglsmlrgemrgyldrgynvvkmkiggapieedrmrieavle eigkdaqlavdangrfnletgiayakmlrdyplfwyeevgdpldyalqaalaefypgpma tgenlfshqdarnllryggmrpdrdwlqfdcalsyglceyqrtlevlkthgwspsrciph gghqmslniaaglglggnesypdlfqpyggfpdgvrvenghitmpdlpgigfegksdlyk emkalae
Timeline for d1tzzb1: