SCOPe 2.08: Domain d1tzzb1: 1tzz B:2146-2392

Lineage for d1tzzb1 (1tzz B:2146-2392)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)

6. Protein Hypothetical protein Bll6730 [117384] (1 species)

7. Species Bradyrhizobium japonicum [TaxId:375] [117385] (1 PDB entry)
   Uniprot Q89FH0

8. Domain d1tzzb1: 1tzz B:2146-2392 [112898]
   Other proteins in same PDB: d1tzza2, d1tzzb2
   Structural genomics target
   complexed with mg

Details for d1tzzb1

PDB Entry: 1tzz, 1.86 Å

PDB Description: crystal structure of the protein l1841, unknown member of enolase superfamily from bradyrhizobium japonicum

PDB Compounds: (B:) Hypothetical protein L1841

SCOPe Domain Sequences for d1tzzb1:

Sequence; same for both SEQRES and ATOM records:

>d1tzzb1 c.1.11.2 (B:2146-2392) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]}
kanprvfvyaaggyyypgkglsmlrgemrgyldrgynvvkmkiggapieedrmrieavle
eigkdaqlavdangrfnletgiayakmlrdyplfwyeevgdpldyalqaalaefypgpma
tgenlfshqdarnllryggmrpdrdwlqfdcalsyglceyqrtlevlkthgwspsrciph
gghqmslniaaglglggnesypdlfqpyggfpdgvrvenghitmpdlpgigfegksdlyk
emkalae

Timeline for d1tzzb1:

• d1tzzb1 first appeared in SCOP 1.71
  
• d1tzzb1 appears in SCOPe 2.07