Lineage for d1tzza1 (1tzz A:1146-1392)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572967Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 573010Family c.1.11.2: D-glucarate dehydratase-like [51609] (11 proteins)
  6. 573058Protein Hypothetical protein Bll6730 [117384] (1 species)
  7. 573059Species Bradyrhizobium japonicum [TaxId:375] [117385] (1 PDB entry)
  8. 573060Domain d1tzza1: 1tzz A:1146-1392 [112896]
    Other proteins in same PDB: d1tzza2, d1tzzb2

Details for d1tzza1

PDB Entry: 1tzz (more details), 1.86 Å

PDB Description: crystal structure of the protein l1841, unknown member of enolase superfamily from bradyrhizobium japonicum

SCOP Domain Sequences for d1tzza1:

Sequence, based on SEQRES records: (download)

>d1tzza1 c.1.11.2 (A:1146-1392) Hypothetical protein Bll6730 {Bradyrhizobium japonicum}
kanprvfvyaaggyyypgkglsmlrgemrgyldrgynvvkmkiggapieedrmrieavle
eigkdaqlavdangrfnletgiayakmlrdyplfwyeevgdpldyalqaalaefypgpma
tgenlfshqdarnllryggmrpdrdwlqfdcalsyglceyqrtlevlkthgwspsrciph
gghqmslniaaglglggnesypdlfqpyggfpdgvrvenghitmpdlpgigfegksdlyk
emkalae

Sequence, based on observed residues (ATOM records): (download)

>d1tzza1 c.1.11.2 (A:1146-1392) Hypothetical protein Bll6730 {Bradyrhizobium japonicum}
kanprvfvyaaggyyglsmlrgemrgyldrgynvvkmkiggapieedrmrieavleeigk
daqlavdangrfnletgiayakmlrdyplfwyeevgdpldyalqaalaefypgpmatgen
lfshqdarnllryggmrpdrdwlqfdcalsyglceyqrtlevlkthgwspsrciphgghq
mslniaaglglggnesypdlfqpyggfpdgvrvenghitmpdlpgigfegksdlykemka
lae

SCOP Domain Coordinates for d1tzza1:

Click to download the PDB-style file with coordinates for d1tzza1.
(The format of our PDB-style files is described here.)

Timeline for d1tzza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tzza2