Lineage for d1tzza1 (1tzz A:1146-1392)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2086988Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2087095Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 protein domains)
  6. 2087149Protein Hypothetical protein Bll6730 [117384] (1 species)
  7. 2087150Species Bradyrhizobium japonicum [TaxId:375] [117385] (1 PDB entry)
    Uniprot Q89FH0
  8. 2087151Domain d1tzza1: 1tzz A:1146-1392 [112896]
    Other proteins in same PDB: d1tzza2, d1tzzb2
    Structural genomics target
    complexed with mg

Details for d1tzza1

PDB Entry: 1tzz (more details), 1.86 Å

PDB Description: Crystal structure of the protein L1841, unknown member of enolase superfamily from Bradyrhizobium japonicum
PDB Compounds: (A:) Hypothetical protein L1841

SCOPe Domain Sequences for d1tzza1:

Sequence, based on SEQRES records: (download)

>d1tzza1 c.1.11.2 (A:1146-1392) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]}
kanprvfvyaaggyyypgkglsmlrgemrgyldrgynvvkmkiggapieedrmrieavle
eigkdaqlavdangrfnletgiayakmlrdyplfwyeevgdpldyalqaalaefypgpma
tgenlfshqdarnllryggmrpdrdwlqfdcalsyglceyqrtlevlkthgwspsrciph
gghqmslniaaglglggnesypdlfqpyggfpdgvrvenghitmpdlpgigfegksdlyk
emkalae

Sequence, based on observed residues (ATOM records): (download)

>d1tzza1 c.1.11.2 (A:1146-1392) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]}
kanprvfvyaaggyyglsmlrgemrgyldrgynvvkmkiggapieedrmrieavleeigk
daqlavdangrfnletgiayakmlrdyplfwyeevgdpldyalqaalaefypgpmatgen
lfshqdarnllryggmrpdrdwlqfdcalsyglceyqrtlevlkthgwspsrciphgghq
mslniaaglglggnesypdlfqpyggfpdgvrvenghitmpdlpgigfegksdlykemka
lae

SCOPe Domain Coordinates for d1tzza1:

Click to download the PDB-style file with coordinates for d1tzza1.
(The format of our PDB-style files is described here.)

Timeline for d1tzza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tzza2